Link type | Probability | Chain C piercings | Chain I piercings | Chain K piercings | Chain P piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K | |||||||||||
view details |
![]() |
Other | 32% | +35K -100K +127K -187K |
Chain C Sequence |
NYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGGGRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQENGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQGLNVLDITNADSLVITEAAAKK |
Chain C Sequence |
MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKKLTVKAHKFSAS |
Chain C Sequence |
RKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRRNAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIELV |
Chain C Sequence |
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKE |
sequence length | 199,131,119,112 |
structure length | 199,131,119,112 |
publication title |
The crystal structure of the large ribosomal subunit of Staphylococcus aureus in complex with lincomycin
rcsb |
molecule tags | Ribosome |
molecule keywords | 23s ribosomal RNA |
pdb deposition date | 2016-01-14 |
LinkProt deposition date | 2017-05-06 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...