| Link type | Probability | Chain B piercings | Chain C piercings | Chain I piercings | Chain Z piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
| view details |
|
Other | 32% | -95Z +165Z | +132B +31C | ||||||||||
Chain B Sequence |
TKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQVGFEDKKAYKKDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEVGQEVSVDTFVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMSHGSHFHRAPGSVGMASDASRVFKGQKMPGRMGGNTVTVQNLEVVQVDTENKVILVKGNVPGPKKGLVEIRTSIK |
Chain B Sequence |
NYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGGGRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQENGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQGLNVLDITNADSLVITEAAAKK |
Chain B Sequence |
MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKKLTVKAHKFSAS |
Chain B Sequence |
AVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGREYKLSHRVC |
| sequence length | 215,199,131,43 |
| structure length | 215,199,131,43 |
| publication title |
The crystal structure of the large ribosomal subunit of Staphylococcus aureus in complex with lincomycin
rcsb |
| molecule tags | Ribosome |
| molecule keywords | 23s ribosomal RNA |
| pdb deposition date | 2016-01-14 |
| LinkProt deposition date | 2017-05-06 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
