| Link type | Probability | Chain A piercings | Chain C piercings | Chain P piercings | Chain U piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
| view details |
|
Other | 33% | -14P +31P | |||||||||||
Chain A Sequence |
IKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVRHHGGGHKRQYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEKRYIIAPKGLEVGQIVESGAEADIKVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNLQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRPSPMSPWGKPTLGKKTRRGKKSSDKLIV |
Chain A Sequence |
NYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGGGRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQENGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQGLNVLDITNADSLVITEAAAKK |
Chain A Sequence |
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKE |
Chain A Sequence |
TGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALK |
| sequence length | 269,199,112,42 |
| structure length | 269,199,112,42 |
| publication title |
The crystal structure of the large ribosomal subunit of Staphylococcus aureus in complex with lincomycin
rcsb |
| molecule tags | Ribosome |
| molecule keywords | 23s ribosomal RNA |
| pdb deposition date | 2016-01-14 |
| LinkProt deposition date | 2017-05-06 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...