| Link type | Probability | Chain 2 piercings | Chain N piercings | Chain Q piercings | Chain V piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
| view details |
|
Other | 30% | ||||||||||||
Chain 2 Sequence |
VKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA |
Chain 2 Sequence |
PRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKLWITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDAL |
Chain 2 Sequence |
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF |
Chain 2 Sequence |
KAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVAREREIEQSK |
| sequence length | 44,116,89,65 |
| structure length | 44,116,89,65 |
| publication title |
The crystal structure of the large ribosomal subunit of Staphylococcus aureus in complex with lincomycin
rcsb |
| molecule tags | Ribosome |
| molecule keywords | 23s ribosomal RNA |
| pdb deposition date | 2016-01-14 |
| LinkProt deposition date | 2017-05-06 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...