| Link type | Probability | Chain A piercings | Chain B piercings | Chain C piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
| view details |
|
Other | 44% | +108B +112C +2D -34D -115D | -115A -114C -115D | ||||||||||
Chain A Sequence |
MVISRAEIYWADLGP-----PAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL |
Chain A Sequence |
MVISRAEIYWADL-------PAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL |
Chain A Sequence |
VISRAEIYWADLGPP----PAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL |
Chain A Sequence |
RAEIYWADL---------KRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL |
| sequence length | 114,114,113,110 |
| structure length | 109,107,109,101 |
| publication title |
Crystal structure of M. tuberculosis MazF-mt3 (Rv1991c) in complex with RNA
rcsb |
| molecule tags | Hydrolase/rna |
| molecule keywords | Endoribonuclease MazF6 |
| source organism | Mycobacterium tuberculosis (strain atcc 25618 / h37rv) |
| missing residues | A: 15-21 B: 13-21 C: 16-21 D: 13-23 |
| pdb deposition date | 2016-01-13 |
| LinkProt deposition date | 2017-01-21 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
