5HDFABCD

Hydrolase semet-stna
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
view details
Other Other 45% +142C -292C -97D -182D -202D +366D +376D +238A -375A -375A -376C -376C +89D -134D -136D -374D +91B -381B
Interpreting sequences
Chain A Sequence
SAICRATTVEVTLGKGTGKMWGELCRPAGSSPDTVVTMVHGATYNHNYWDFPYQPDKYSFRKMLNGAGYATFVVDRLGTGNSTVPPSSELNLTVEARQMHEVVQGLRTGRIGGTGFGKVVLAGYSLGSAVTSIEASTFHDVDAVLITALGHYNNPAGTQAIIDNGLSPNDDPVLKDRHHYDDGYATTKPGSRKHVFYADRPMDPGVLATDELTKDANVFTEAADPLVIDPAVSRAIDVPVMFALGDRDPLMCGDGYEDCSSQAALRAQEAPFWTSAPSFDVILVEDAGHGLNLVPNTRVYQDASRDWLDRVVGHG
Chain A Sequence
SAICRATTVEVTLGKGTGKMWGELCRPAGSSPDTVVTMVHGATYNHNYWDFPYQPDKYSFRKMLNGAGYATFVVDRLGTGNSTVPPSSELNLTVEARQMHEVVQGLRTGRIGGTGFGKVVLAGYSLGSAVTSIEASTFHDVDAVLITALGHYNNPAGTQAIIDNGLSPNDDPVLKDRHHYDDGYATTKPGSRKHVFYADRPMDPGVLATDELTKDANVFTEAADPLVIDPAVSRAIDVPVMFALGDRDPLMCGDGYEDCSSQAALRAQEAPFWTSAPSFDVILVEDAGHGLNLVPNTRVYQDASRDWLDRVVGHGLEHHH
Chain A Sequence
SAICRATTVEVTLGKGTGKMWGELCRPAGSSPDTVVTMVHGATYNHNYWDFPYQPDKYSFRKMLNGAGYATFVVDRLGTGNSTVPPSSELNLTVEARQMHEVVQGLRTGRIGGTGFGKVVLAGYSLGSAVTSIEASTFHDVDAVLITALGHYNNPAGTQAIIDNGLSPNDDPVLKDRHHYDDGYATTKPGSRKHVFYADRPMDPGVLATDELTKDANVFTEAADPLVIDPAVSRAIDVPVMFALGDRDPLMCGDGYEDCSSQAALRAQEAPFWTSAPSFDVILVEDAGHGLNLVPNTRVYQDASRDWLDRVVGHGL
Chain A Sequence
SAICRATTVEVTLGKGTGKMWGELCRPAGSSPDTVVTMVHGATYNHNYWDFPYQPDKYSFRKMLNGAGYATFVVDRLGTGNSTVPPSSELNLTVEARQMHEVVQGLRTGRIGGTGFGKVVLAGYSLGSAVTSIEASTFHDVDAVLITALGHYNNPAGTQAIIDNGLSPNDDPVLKDRHHYDDGYATTKPGSRKHVFYADRPMDPGVLATDELTKDANVFTEAADPLVIDPAVSRAIDVPVMFALGDRDPLMCGDGYEDCSSQAALRAQEAPFWTSAPSFDVILVEDAGHGLNLVPNTRVYQDASRDWLDRVVGHGL
sequence length 315,320,316,316
structure length 315,320,316,316
publication title Crystal structure of a hydrolase StnA at 2.2 Angstroms resolution from Streptomyces flocculus
rcsb
molecule tags Hydrolase
molecule keywords Hydrolase
source organism Streptomyces flocculus
pdb deposition date2016-01-05
LinkProt deposition date2017-01-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling