5H4DACDH

Crystal structure of hsirt3 in complex with a specific agonist amiodarone hydrochloride
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain D piercings Chain H piercings
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
view details
Other Other 41% -A +325D -391D -4H -392A
Interpreting sequences
Chain A Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
Chain A Sequence
RHK
Chain A Sequence
RHK
Chain A Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
sequence length 271,3,3,271
structure length 271,3,3,271
publication title Crystal structure of hSIRT3 in complex with a specific agonist Amiodarone hydrochloride
rcsb
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
source organism Homo sapiens
pdb deposition date2016-10-31
LinkProt deposition date2017-11-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling