| Link type | Probability | Chain D piercings | Chain F piercings | Chain G piercings | Chain I piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
| view details |
|
Other | 32% | ||||||||||||
Chain D Sequence |
MYMILELLNIIGIIAFTISGSLKGTNKGLDIFGVVTLGVITSYAGGIIADILLGIYPPQILKELNYLLLSVGISIFVFYFYKWLQTNPIKMIIAISDAVGLSTFATLGASLAYSYGLNPISVGLIAAIVGTGGGVIRDVLVNEIPMVLTKEIYATAALLSGFIYYFTTPYLHHDSLFVAFLGSFLLRILSIKYNF |
Chain D Sequence |
VKLVESGGGLVKPGGSLKLSCAASGFGFTIYDMSWVRQTPEKRLEWVAYMSSGRGNTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTRGAFYYGYGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG |
Chain D Sequence |
DIVMTQTPLSLPVSLGDQASISCRSSQFIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN |
Chain D Sequence |
DIVMTQTPLSLPVSLGDQASISCRSSQFIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN |
| sequence length | 195,220,217,217 |
| structure length | 195,220,217,217 |
| publication title |
Crystal structures of the TRIC trimeric intracellular cation channel orthologues
pubmed doi rcsb |
| molecule tags | Immune system/membrane protein |
| molecule keywords | Fab Heavy Chain |
| source organism | Mus musculus |
| pdb deposition date | 2016-10-20 |
| LinkProt deposition date | 2017-01-14 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
