5H1SSTUe

Structure of the large subunit of the chloro-ribosome
Link type Probability Chain S piercings Chain T piercings Chain U piercings Chain e piercings
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
view details
Other Other 30% +198T -208T +235T +21U +44U -117U +26S -149S +159S -170S
Interpreting sequences
Chain S Sequence
RVKRGYIARRRRKKIRFFASSFRGAHSRLTRTIAQQKIRALVSAHRDRDRQKRDFRRLWITRINAAIRERGVYYNYSKFIHDLYKRQLLLNRKILAQIAILNPNCIYMIYNEIIK
Chain S Sequence
VLPDDFQAPEPGTPEYNDIINQFLPKKGPPPPREEIFAVVVIGSRQYIVIPGRWIYTQRLKGATVNDKIVLNKVLLVGTKASTYIGTPIVTNAAVHAVVEEQLLDDKVIVFKYKKKKNYRRNIGHRQPITRIKITGITGYEDYPAST
Chain S Sequence
PGKCDEITTRGYSISMSVDKARRVIDQIRGRSYAETLMILELMPYRACYPIFKLIYSAAANASHNKQFNKANLIISKAEVNKGITLKKVKPRARGRSYMIKRPTCHITIVLRDITHFDSYDKFLESLTPKKLIALLGLMSTGRR
Chain S Sequence
GYKMKTHKASAKRFRVTGKGKIVRRRAGKQHLLAKKNTKRKNRLSKLIQVDRSDYDNVIGALPYLKVNR
sequence length 115,147,144,69
structure length 115,147,144,69
publication title Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S rRNA
pdb deposition date2016-10-11
LinkProt deposition date2017-02-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling