| Link type | Probability | Chain P piercings | Chain S piercings | Chain T piercings | Chain b piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
| view details |
|
Other | 36% | +48S +126T -234b | -126P +20b -47b +109b -121b | +194P +234P +9S +118S | |||||||||
Chain P Sequence |
MKHGRKIHRLSRPADQRRALLRGLTTQLLKHGRIKTTRAKASAMRKYVDKMITLAKEGSLHKRRQALGFIYEKQIVHALFAEVPERYGDRNGGYTRIIRTLPRRGDNAPMAYIELV |
Chain P Sequence |
RVKRGYIARRRRKKIRFFASSFRGAHSRLTRTIAQQKIRALVSAHRDRDRQKRDFRRLWITRINAAIRERGVYYNYSKFIHDLYKRQLLLNRKILAQIAILNPNCIYMIYNEIIK |
Chain P Sequence |
VLPDDFQAPEPGTPEYNDIINQFLPKKGPPPPREEIFAVVVIGSRQYIVIPGRWIYTQRLKGATVNDKIVLNKVLLVGTKASTYIGTPIVTNAAVHAVVEEQLLDDKVIVFKYKKKKNYRRNIGHRQPITRIKITGITGYEDYPAST |
Chain P Sequence |
AVPKKRTSIYKKRIRKNIWKKKGYWAALKAFSLAKSLSTGNSKSFF |
| sequence length | 116,115,147,46 |
| structure length | 116,115,147,46 |
| publication title |
Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb |
| molecule tags | Ribosome |
| molecule keywords | 23S rRNA |
| pdb deposition date | 2016-10-11 |
| LinkProt deposition date | 2017-02-06 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
