| Link type | Probability | Chain O piercings | Chain T piercings | Chain f piercings | Chain h piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
| view details |
|
Other | 37% | ||||||||||||
Chain O Sequence |
LSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEISGVAENIARRAVAIAASKMPIRTQFIISG |
Chain O Sequence |
VLPDDFQAPEPGTPEYNDIINQFLPKKGPPPPREEIFAVVVIGSRQYIVIPGRWIYTQRLKGATVNDKIVLNKVLLVGTKASTYIGTPIVTNAAVHAVVEEQLLDDKVIVFKYKKKKNYRRNIGHRQPITRIKITGITGYEDYPAST |
Chain O Sequence |
MKIRASVRPICEKCRLIRRRGRIIVICSNPKHKQRQG |
Chain O Sequence |
SSRPQKKGTAHHMKTRPKKTARWDIKRGPAVYPPLPPLPAEWTIVS |
| sequence length | 134,147,37,46 |
| structure length | 134,147,37,46 |
| publication title |
Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb |
| molecule tags | Ribosome |
| molecule keywords | 23S rRNA |
| pdb deposition date | 2016-10-11 |
| LinkProt deposition date | 2017-02-06 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
