| Link type | Probability | Chain N piercings | Chain T piercings | Chain e piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
| view details |
|
Hopf.2 U Ring | 34% | -109N +133N -157N -136e | ||||||||||
Chain N Sequence |
FRLDNLGPQPGSRKKGKRKGRGHAAGQGGSCGFGMRGQKSRSGPGIMRGFEGGQMPLYRRIPKLRGIAGGMRAGLPKYVPINLRDIEVAGFKEGEEVSLESLKAKGIINPSGRERRLPLKILGEGELSTKLQIKARAFSGSAKEKLEAAGCSVTVLPGRKKYIKESVRKNLARADEY |
Chain N Sequence |
VLPDDFQAPEPGTPEYNDIINQFLPKKGPPPPREEIFAVVVIGSRQYIVIPGRWIYTQRLKGATVNDKIVLNKVLLVGTKASTYIGTPIVTNAAVHAVVEEQLLDDKVIVFKYKKKKNYRRNIGHRQPITRIKITGITGYEDYPAST |
Chain N Sequence |
GYKMKTHKASAKRFRVTGKGKIVRRRAGKQHLLAKKNTKRKNRLSKLIQVDRSDYDNVIGALPYLKVNR |
| sequence length | 177,147,69 |
| structure length | 177,147,69 |
| publication title |
Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb |
| molecule tags | Ribosome |
| molecule keywords | 23S rRNA |
| pdb deposition date | 2016-10-11 |
| LinkProt deposition date | 2017-02-06 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
