5H1SLOfh

Structure of the large subunit of the chloro-ribosome
Link type Probability Chain L piercings Chain O piercings Chain f piercings Chain h piercings
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
view details
Other Other 33% -94f -243h
Interpreting sequences
Chain L Sequence
WYPKSADHVPTDKKWYVVDATDLILGRMASTIAIHIRGKNLASYTPSVDMGAFVIVVNADKVAVSGKKRTQKLYRRHSGRPGGLKEETFDQLQKRIPERIIEHAVRGMLPKGRLGRYLFNHLKVYKGAEHPHQAQQPIDLPLRDKRI
Chain L Sequence
LSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEISGVAENIARRAVAIAASKMPIRTQFIISG
Chain L Sequence
MKIRASVRPICEKCRLIRRRGRIIVICSNPKHKQRQG
Chain L Sequence
SSRPQKKGTAHHMKTRPKKTARWDIKRGPAVYPPLPPLPAEWTIVS
sequence length 147,134,37,46
structure length 147,134,37,46
publication title Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S rRNA
pdb deposition date2016-10-11
LinkProt deposition date2017-02-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling