| Link type | Probability | Chain G piercings | Chain Y piercings | Chain b piercings | Chain d piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
| view details |
|
Other | 33% | -148b -103d -143d +234d | |||||||||||
Chain G Sequence |
LIPLPILNFSGEKVGETFLNLKTAPPEKARAVVHRGLITHLQNKRRGTASTLTRAEVRGGGRKPYPQKKTGRARRGSQGSPLRPGGGVIFGPKPRDWTIKMNKKERRLALSTAIASAVGNSFVVEEFAENFEKPKTKDFIAAMQRWGLDPAEKSLFFLMDLVENVEKSGRNIRTLKLLTPRSLNLFDVLNAEKLVFTEGTIQYLNQRYGV |
Chain G Sequence |
RRICPFTGKKSNKANRVSHSNHKTKRLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKNGLDAVAKKAGIDL |
Chain G Sequence |
AVPKKRTSIYKKRIRKNIWKKKGYWAALKAFSLAKSLSTGNSKSFF |
Chain G Sequence |
AALCLTKRSRSRKSLARTHGFRLRMSTTSGRALLKRRRAKGRKILCTKTNPSSGKRA |
| sequence length | 210,74,46,57 |
| structure length | 210,74,46,57 |
| publication title |
Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb |
| molecule tags | Ribosome |
| molecule keywords | 23S rRNA |
| pdb deposition date | 2016-10-11 |
| LinkProt deposition date | 2017-02-06 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
