5H1SESTd

Structure of the large subunit of the chloro-ribosome
Link type Probability Chain E piercings Chain S piercings Chain T piercings Chain d piercings
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
view details
Other Other 32% -235d -269E +234E +234E +20S +95S +147d +148d
Interpreting sequences
Chain E Sequence
NPRNNLISGQRRCGKGRNARGIITARHRGGGHKRLYRKIDFRRNEKDIYGKIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEVPIKMGNALPLTDMPLGTAIHNIEITLGRGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKRLGRAGSKRWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKSPTTPWGYPALGRRSRKRNKYSDNFIIRR
Chain E Sequence
RVKRGYIARRRRKKIRFFASSFRGAHSRLTRTIAQQKIRALVSAHRDRDRQKRDFRRLWITRINAAIRERGVYYNYSKFIHDLYKRQLLLNRKILAQIAILNPNCIYMIYNEIIK
Chain E Sequence
VLPDDFQAPEPGTPEYNDIINQFLPKKGPPPPREEIFAVVVIGSRQYIVIPGRWIYTQRLKGATVNDKIVLNKVLLVGTKASTYIGTPIVTNAAVHAVVEEQLLDDKVIVFKYKKKKNYRRNIGHRQPITRIKITGITGYEDYPAST
Chain E Sequence
AALCLTKRSRSRKSLARTHGFRLRMSTTSGRALLKRRRAKGRKILCTKTNPSSGKRA
sequence length 247,115,147,57
structure length 247,115,147,57
publication title Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S rRNA
pdb deposition date2016-10-11
LinkProt deposition date2017-02-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling