| Link type | Probability | Chain A piercings | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
| view details |
|
Hopf.1 U Ring | 37% | +75B +74D | +86A -245A -109B +251B | |||||||||
Chain A Sequence |
DSMLARVVRVLETFNVDRTAQTASDIGRRAALPSSTAHRVVDEMVLVGILERGIDGKVRLGMRLWELALRGSMALRLRQVALPHMERVQQRVREHTQLAVLEHNEVLFLERLSHHEAVSNLA-----LPVHASSSGLMLLAHAGPEVREEVLSKPLPRVGPGTVTDPEALRRLLANAYRAGYVAAPGYIEAVATGIAVPIRSEGVVIAALSAVQPLQNAVEPTVEILREAAVGIETDLRASRW |
Chain A Sequence |
DSMLARVVRVLETFNVDRTAQTASDIGRRAALPSSTAHRVVDEMVLVGILERGIDGKVRLGMRLWELALRGSMALRLRQVALPHMERVQQRVREHTQLAVLEHNEVLFLERLSHHEAVSNLARVAGRLPVHASSSGLMLLAHAGPEVREEVLSKPLPRVGPGTVTDPEALRRLLANAYRAGYVAAPGYIEAVATGIAVPIRSEGVVIAALSAVQPLQNAVEPTVEILREAAVGIETDLRASRW |
Chain A Sequence |
SGDSMLARVVRVLETFNVDRTAQTASDIGRRAALPSSTAHRVVDEMVLVGILERGIDGKVRLGMRLWELALRGSMALRLRQVALPHMERVQQRVREHTQLAVLEHNEVLFLERLSHHEAVSNLARVAGRLPVHASSSGLMLLAHAGPEVREEVLSKPLPRVGPGTVTDPEALRRLLANAYRAGYVAAPGYIEAVATGIAVPIRSEGVVIAALSAVQPLQNAVEPTVEILREAAVGIETDL |
| sequence length | 243,243,240 |
| structure length | 238,243,240 |
| publication title |
Crystal structure of an IclR homologue from Microbacterium sp. strain HM58-2.
pubmed doi rcsb |
| molecule tags | Transcription regulator |
| molecule keywords | IclR transcription factor homolog |
| source organism | Microbacterium sp. |
| missing residues | A: 129-135 |
| pdb deposition date | 2016-10-08 |
| LinkProt deposition date | 2017-01-21 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
