5GWZABDE

The structure of porcine epidemic diarrhea virus main protease in complex with an inhibitor
Link type Probability Chain A piercings Chain B piercings Chain D piercings Chain E piercings
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
view details
Other Other 37% +16B -90B -4E -301A
Interpreting sequences
Chain A Sequence
GLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVGNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGHTSLTDEFTTGEVVRQMYGVN
Chain A Sequence
GLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVGNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGHTSLTDEFTTGEVVRQMYGVN
Chain A Sequence
AVL
Chain A Sequence
AVL
sequence length 299,299,3,3
structure length 299,299,3,3
publication title Michael Acceptor-Based Peptidomimetic Inhibitor of Main Protease from Porcine Epidemic Diarrhea Virus
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PEDV main protease
source organism Porcine epidemic diarrhea virus cv777
pdb deposition date2016-09-14
LinkProt deposition date2017-03-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling