| Link type | Probability | Loop ranges | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
| view details |
|
Hopf.2 | 51% | -B | -130D +160D -198D | -258B -261B +278B | ||||||||
Chain B Sequence |
PSTPTILGYEVMEERAKFTVYKILVKK-PEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSL |
Chain B Sequence |
RPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRW--DNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSL |
| sequence length | 171,172 |
| structure length | 170,170 |
| publication title |
SNX16 Regulates the Recycling of E-Cadherin through a Unique Mechanism of Coordinated Membrane and Cargo Binding.
pubmed doi rcsb |
| molecule tags | Protein transport |
| molecule keywords | Sorting nexin-16 |
| source organism | Homo sapiens |
| missing residues | B: 133-135 D: 171-174 |
| pdb deposition date | 2016-09-08 |
| LinkProt deposition date | 2017-09-16 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...