5GULABCD

Crystal structure of tris/ppix2/mg2+ bound form of cyclolavandulyl diphosphate synthase (clds) from streptomyces sp. cl190
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
view details
Other Other 36% -A +218D +54A +12D -55D -90D +134D +205B -218B
Interpreting sequences
Chain A Sequence
TTLMLLPDGMRRWSEKNGVSLDDGYAAMGDKIIEFMGWAKEEGVKTLYITASSAANHGRPEAAVNTFMEAFTEVIRRCHSQFKFDFSGSLDLVSEDYLTELSALRDKSDSESDFTLHYILGMSLSHEVVGIFNKLNGKIPEMTEEILAENAYVPTQVDYIIRTGGAIRMSSFFPLMSPYAELHFSPVLFPDTTRADFDAALKDLRARDRRFGGYPA
Chain A Sequence
TTLMLLPDGMRRWSEKNGVSLDDGYAAMGDKIIEFMGWAKEEGVKTLYITASSAANHGRPEAAVNTFMEAFTEVIRRCHSQFKFDFSGSLDLVSEDYLTELSALRDKSDSESDFTLHYILGMSLSHEVVGIFNKLNGKIPEMTEEILAENAYVPTQVDYIIRTGGAIRMSSFFPLMSPYAELHFSPVLFPDTTRADFDAALKDLRARDRRFGGYPA
Chain A Sequence
TTLMLLPDGMRRWSEKNGVSLDDGYAAMGDKIIEFMGWAKEEGVKTLYITASSAANHGRPEAAVNTFMEAFTEVIRRCHSQFKFDFSGSLDLVSEDYLTELSALRDKSDSESDFTLHYILGMSLSHEVVGIFNKLNGKIPEMTEEILAENAYVPTQVDYIIRTGGAIRMSSFFPLMSPYAELHFSPVLFPDTTRADFDAALKDLRARDRRFGGYPA
Chain A Sequence
TTLMLLPDGMRRWSEKNGVSLDDGYAAMGDKIIEFMGWAKEEGVKTLYITASSAANHGRPEAAVNTFMEAFTEVIRRCHSQFKFDFSGSLDLVSEDYLTELSALRDKSDSESDFTLHYILGMSLSHEVVGIFNKLNGKIPEMTEEILAENAYVPTQVDYIIRTGGAIRMSSFFPLMSPYAELHFSPVLFPDTTRADFDAALKDLRARDRRFGGYPA
sequence length 216,216,216,216
structure length 216,216,216,216
publication title Structural insight into both condensation and subsequent cyclization of C5 isoprene units catalyzed by cyclolavandulyl diphosphate synthase
rcsb
molecule tags Biosynthetic protein
molecule keywords Cyclolavandulyl diphosphate synthase
source organism Streptomyces sp. (strain cl190)
pdb deposition date2016-08-29
LinkProt deposition date2017-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling