| Link type | Probability | Chain b piercings | Chain f piercings | Chain t piercings | Chain v piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
| view details |
|
Other | 31% | -464b +481b -137t -378v | |||||||||||
Chain b Sequence |
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTR |
Chain b Sequence |
IFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR |
Chain b Sequence |
ETITYVFIFACIIALFFFAIFFREPPRIT |
Chain b Sequence |
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY |
| sequence length | 504,31,29,137 |
| structure length | 504,31,29,137 |
| publication title |
Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 |
| pdb deposition date | 2016-08-20 |
| LinkProt deposition date | 2017-03-18 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...