| Link type | Probability | Chain M piercings | Chain c piercings | Chain e piercings | Chain y piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
| view details |
|
Other | 40% | -474c -34e | -47e -33y | +46y | |||||||||
Chain M Sequence |
EVNQLGLIATALFVLVPSVFLIILYVQTESQQ |
Chain M Sequence |
NSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD |
Chain M Sequence |
GERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain M Sequence |
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL |
| sequence length | 32,455,79,29 |
| structure length | 32,455,79,29 |
| publication title |
Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 |
| pdb deposition date | 2016-08-20 |
| LinkProt deposition date | 2017-03-18 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
