| Link type | Probability | Chain D piercings | Chain K piercings | Chain R piercings | Chain Y piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
| view details |
|
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
Chain D Sequence |
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL |
Chain D Sequence |
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR |
Chain D Sequence |
DWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLL |
Chain D Sequence |
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL |
| sequence length | 342,37,34,29 |
| structure length | 342,37,34,29 |
| publication title |
Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 |
| pdb deposition date | 2016-08-20 |
| LinkProt deposition date | 2017-03-18 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...