Link type | Probability | Chain D piercings | Chain K piercings | Chain R piercings | Chain Y piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y | |||||||||
view details |
![]() |
Other | 47% | -47K -47K -71R -114R -36Y | -353D | +47Y |
Chain D Sequence |
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL |
Chain D Sequence |
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR |
Chain D Sequence |
DWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLL |
Chain D Sequence |
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL |
sequence length | 342,37,34,29 |
structure length | 342,37,34,29 |
publication title |
Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb |
molecule tags | Photosynthesis |
molecule keywords | Photosystem II protein D1 |
pdb deposition date | 2016-08-20 |
LinkProt deposition date | 2017-03-18 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...