5GTHDJRY

Native xfel structure of photosystem ii (dark dataset)
Link type Probability Chain D piercings Chain J piercings Chain R piercings Chain Y piercings
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
view details
Other Other 46% +35Y +352D -47R -353Y +46Y
Interpreting sequences
Chain D Sequence
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Chain D Sequence
SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Chain D Sequence
DWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLL
Chain D Sequence
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL
sequence length 342,38,34,29
structure length 342,38,34,29
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
pdb deposition date2016-08-20
LinkProt deposition date2017-03-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling