5GTHDJMX

Native xfel structure of photosystem ii (dark dataset)
Link type Probability Chain D piercings Chain J piercings Chain M piercings Chain X piercings
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
view details
Other Other 34% +39J +131M +174M -353M -14X +353X
Interpreting sequences
Chain D Sequence
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Chain D Sequence
SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Chain D Sequence
EVNQLGLIATALFVLVPSVFLIILYVQTESQQ
Chain D Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQR
sequence length 342,38,32,38
structure length 342,38,32,38
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
pdb deposition date2016-08-20
LinkProt deposition date2017-03-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling