5GSQABCD

Crystal structure of igg fc with a homogeneous glycoform and antibody-dependent cellular cytotoxicity
D: 265-270,293-297,324-329
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
view details
Other Other 40% +364A -412A -246D -364D +389D -411D
Interpreting sequences
Chain A Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Chain A Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Chain A Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Chain A Sequence
VFLFPPKPKDTLMISRTPEVTCVVVD----DPEVKFNWYVDGVEVHNAKTKPRE---NSTYRVVSVLTVLHQDWLNGKEYKCKVS----PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
sequence length 208,208,208,205
structure length 208,208,208,194
publication title Crystal Structure of a Homogeneous IgG-Fc Glycoform with the N-Glycan Designed to Maximize the Antibody Dependent Cellular Cytotoxicity
pubmed doi rcsb
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
source organism Homo sapiens
missing residues D: 265-270,293-297,324-329
pdb deposition date2016-08-17
LinkProt deposition date2017-06-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling