5GSEEGKO

Crystal structure of unusual nucleosome
Link type Probability Chain E piercings Chain G piercings Chain K piercings Chain O piercings
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
view details
Other Other 39% +38K -61K +93K -135K +134O
Interpreting sequences
Chain E Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Chain E Sequence
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLP
Chain E Sequence
ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Chain E Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
sequence length 97,109,88,96
structure length 97,109,88,96
publication title Crystal structure of the overlapping dinucleosome composed of hexasome and octasome
pubmed doi rcsb
molecule tags Structural protein/dna
molecule keywords Histone H3.1
source organism Homo sapiens
pdb deposition date2016-08-16
LinkProt deposition date2017-05-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling