5GSECDGM

Crystal structure of unusual nucleosome
Link type Probability Chain C piercings Chain D piercings Chain G piercings Chain M piercings
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
view details
Other Other 33% +37D -60D +27G -51G +117M +118C +32D -123D
Interpreting sequences
Chain C Sequence
TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLP
Chain C Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
Chain C Sequence
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLP
Chain C Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLP
sequence length 102,92,109,106
structure length 102,92,109,106
publication title Crystal structure of the overlapping dinucleosome composed of hexasome and octasome
pubmed doi rcsb
molecule tags Structural protein/dna
molecule keywords Histone H3.1
source organism Homo sapiens
pdb deposition date2016-08-16
LinkProt deposition date2017-05-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling