Link type | Probability | Chain B piercings | Chain F piercings | Chain G piercings | Chain P piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P | |||||||||||
view details |
![]() |
Unlink | 34% | +61P -86P |
Chain B Sequence |
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
Chain B Sequence |
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG |
Chain B Sequence |
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLP |
Chain B Sequence |
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG |
sequence length | 82,79,109,81 |
structure length | 82,79,109,81 |
publication title |
Crystal structure of the overlapping dinucleosome composed of hexasome and octasome
pubmed doi rcsb |
molecule tags | Structural protein/dna |
molecule keywords | Histone H3.1 |
source organism | Homo sapiens |
pdb deposition date | 2016-08-16 |
LinkProt deposition date | 2017-05-06 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...