| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
| view details |
|
Hopf.1 U Ring | 30% | -A | +42B -79B +89B +33D | ||||||||||
Chain A Sequence |
MSNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEIFKAGLELQ |
Chain A Sequence |
MSNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEIFKAGLELQEE |
Chain A Sequence |
MSNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEIFKAGLELQE |
| sequence length | 86,88,87 |
| structure length | 86,88,87 |
| publication title |
Crystal structure of chorismate mutase like domain of bifunctional DAHP synthase of Bacillus subtilis in complex with Chlorogenic acid
rcsb |
| molecule tags | Isomerase |
| molecule keywords | Protein AroA(G) |
| source organism | Bacillus subtilis subsp. subtilis str. 168 |
| pdb deposition date | 2016-07-26 |
| LinkProt deposition date | 2017-08-29 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...