5GO2ABCD

Crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with citrate
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
view details
Other Other 56% -A +33B +48C -71C +87C -89D -16A
Interpreting sequences
Chain A Sequence
MSNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEIFKAGLELQ
Chain A Sequence
MSNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEIFKAGLELQEE
Chain A Sequence
SNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEIFKAGLELQEE
Chain A Sequence
MSNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEIFKAGLELQE
sequence length 86,88,87,87
structure length 86,88,87,87
publication title Crystal structure of chorismate mutase like domain of bifunctional DAHP synthase of Bacillus subtilis in complex with Chlorogenic acid
rcsb
molecule tags Isomerase
molecule keywords Protein AroA(G)
source organism Bacillus subtilis subsp. subtilis str. 168
pdb deposition date2016-07-26
LinkProt deposition date2017-08-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling