5GNAAB

Crystal structure of flagellin assembly related protein
Link type Probability Loop ranges Chain A piercings Chain B piercings
view details
Unlink Unlink 50% -A +439B -467B
view details
Unlink Unlink 50% -A +439B -467B
view details
Unlink Unlink 50% -A +439B -467B
view details
Unlink Unlink 50% -A +439B -467B
view details
Unlink Unlink 50% -A +439B -467B
Interpreting sequences
Chain A Sequence
GSMTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIG
Chain A Sequence
NATLKSLTKQYLSVSNSIDETVARYKAQFTQLDTMMSKLNNTSSYLTQQFTAMNKS
sequence length 96,56
structure length 96,56
publication title Crystal Structure of flagellin assembly related protein
rcsb
molecule tags Gene regulation
molecule keywords Flagellar protein FliT
source organism Salmonella typhimurium (strain lt2 / sgsc1412 / atcc 700720)
pdb deposition date2016-07-20
LinkProt deposition date2017-08-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling