5GJQcqrs

Structure of the human 26s proteasome bound to usp14-ubal
Link type Probability Chain c piercings Chain q piercings Chain r piercings Chain s piercings
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
view details
Other Other 36% -205q -206r +5r -168r -202r -206s +31s
Interpreting sequences
Chain c Sequence
SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
Chain c Sequence
SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
Chain c Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQ
Chain c Sequence
TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSG
sequence length 204,204,199,201
structure length 204,204,199,201
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
ec nomenclature ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
cqrs PF00227 ProteasomeProteasome subunit
cqrs PF00227 ProteasomeProteasome subunit
cqrs PF00227 ProteasomeProteasome subunit
cqrs PF00227 ProteasomeProteasome subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling