| Link type | Probability | Chain c piercings | Chain d piercings | Chain q piercings | Chain r piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
| view details |
|
Other | 30% | +199d +200d +53q +119q -205r | -206c +24q +126q +200q +205r +205r +205r | ||||||||||
Chain c Sequence |
SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD |
Chain c Sequence |
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQ |
Chain c Sequence |
SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD |
Chain c Sequence |
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQ |
| sequence length | 204,199,204,199 |
| structure length | 204,199,204,199 |
| publication title |
An atomic structure of the human 26S proteasome.
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | Proteasome subunit beta type-6 |
| source organism | Homo sapiens |
| ec nomenclature |
ec 3.4.25.1: Proteasome endopeptidase complex. ec 3.4.25.1: Proteasome endopeptidase complex. ec 3.4.25.1: Proteasome endopeptidase complex. ec 3.4.25.1: Proteasome endopeptidase complex. |
| pdb deposition date | 2016-07-01 |
| LinkProt deposition date | 2016-09-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| cdqr | PF00227 | Proteasome | Proteasome subunit |
| cdqr | PF00227 | Proteasome | Proteasome subunit |
| cdqr | PF00227 | Proteasome | Proteasome subunit |
| cdqr | PF00227 | Proteasome | Proteasome subunit |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
