5GJQQhio

Structure of the human 26s proteasome bound to usp14-ubal
Link type Probability Chain Q piercings Chain h piercings Chain i piercings Chain o piercings
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
view details
Other Other 35% -246h -423i +231Q +30h
Interpreting sequences
Chain Q Sequence
AAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT
Chain Q Sequence
SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAER
Chain Q Sequence
AERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAA
Chain Q Sequence
TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATL
sequence length 421,244,231,202
structure length 421,244,231,202
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
ec nomenclature ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
Qhio PF01399 PCIPCI domain
Qhio PF00227 ProteasomeProteasome subunit
Qhio PF10584 Proteasome_A_NProteasome subunit A N-terminal signature
Qhio PF00227 ProteasomeProteasome subunit
Qhio PF10584 Proteasome_A_NProteasome subunit A N-terminal signature
Qhio PF00227 ProteasomeProteasome subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling