5GJQQRYh

Structure of the human 26s proteasome bound to usp14-ubal
Y: 27-35
Link type Probability Chain Q piercings Chain R piercings Chain Y piercings Chain h piercings
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
view details
Other Other 41% -304R +318R +390R +422Y -68h -422Q -245Y -422h +69Q -325R +357R +390R
Interpreting sequences
Chain Q Sequence
AAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT
Chain Q Sequence
NPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Chain Q Sequence
EKKQPVDLGLLEEDDEFEEFPAEDW-------DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKME
Chain Q Sequence
SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAER
sequence length 421,376,66,244
structure length 421,376,59,244
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
missing residues Y: 27-35
ec nomenclature ec 3.4.25.1: Proteasome endopeptidase complex.
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
QRYh PF01399 PCIPCI domain
QRYh PF01399 PCIPCI domain
QRYh PF10602 RPN726S proteasome subunit RPN7
QRYh PF05160 DSS1_SEM1DSS1/SEM1 family
QRYh PF00227 ProteasomeProteasome subunit
QRYh PF10584 Proteasome_A_NProteasome subunit A N-terminal signature
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling