5GJQQRUh

Structure of the human 26s proteasome bound to usp14-ubal
U: 142-152
Link type Probability Chain Q piercings Chain R piercings Chain U piercings Chain h piercings
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
view details
Other Other 36% +296h +404Q -245U -422h -296Q -296Q -26R -190R -287R +389R +246h
Interpreting sequences
Chain Q Sequence
AAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT
Chain Q Sequence
NPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Chain Q Sequence
LAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVE---------SKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEE
Chain Q Sequence
SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAER
sequence length 421,376,292,244
structure length 421,376,283,244
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
missing residues U: 142-152
ec nomenclature ec 3.4.25.1: Proteasome endopeptidase complex.
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
QRUh PF01399 PCIPCI domain
QRUh PF01399 PCIPCI domain
QRUh PF10602 RPN726S proteasome subunit RPN7
QRUh PF01398 JABJAB1/Mov34/MPN/PAD-1 ubiquitin protease
QRUh PF13012 MitMem_regMaintenance of mitochondrial structure and function
QRUh PF00227 ProteasomeProteasome subunit
QRUh PF10584 Proteasome_A_NProteasome subunit A N-terminal signature
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling