5GJQQRUY

Structure of the human 26s proteasome bound to usp14-ubal
U: 142-152 Y: 27-35
Link type Probability Chain Q piercings Chain R piercings Chain U piercings Chain Y piercings
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
view details
Other Other 32% -389R -411U -295Y -418Q -69U -333Y +295Q +389R -69Y
Interpreting sequences
Chain Q Sequence
AAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT
Chain Q Sequence
NPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Chain Q Sequence
LAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVE---------SKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEE
Chain Q Sequence
EKKQPVDLGLLEEDDEFEEFPAEDW-------DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKME
sequence length 421,376,292,66
structure length 421,376,283,59
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
missing residues U: 142-152 Y: 27-35
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
QRUY PF01399 PCIPCI domain
QRUY PF01399 PCIPCI domain
QRUY PF10602 RPN726S proteasome subunit RPN7
QRUY PF01398 JABJAB1/Mov34/MPN/PAD-1 ubiquitin protease
QRUY PF13012 MitMem_regMaintenance of mitochondrial structure and function
QRUY PF05160 DSS1_SEM1DSS1/SEM1 family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling