5GJQORUY

Structure of the human 26s proteasome bound to usp14-ubal
O: 54-57 U: 142-152 Y: 27-35
Link type Probability Chain O piercings Chain R piercings Chain U piercings Chain Y piercings
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
view details
Other Other 31% -389R -377U +191Y -230Y +296Y +376O +68U +376Y -265O +295O +230R -389R -69Y
Interpreting sequences
Chain O Sequence
DVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGD--IKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWCTDVKSMEMLVEHQAHDILT
Chain O Sequence
NPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Chain O Sequence
LAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVE---------SKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEE
Chain O Sequence
EKKQPVDLGLLEEDDEFEEFPAEDW-------DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKME
sequence length 374,376,292,66
structure length 372,376,283,59
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
missing residues O: 54-57 U: 142-152 Y: 27-35
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ORUY PF01399 PCIPCI domain
ORUY PF01399 PCIPCI domain
ORUY PF10602 RPN726S proteasome subunit RPN7
ORUY PF01398 JABJAB1/Mov34/MPN/PAD-1 ubiquitin protease
ORUY PF13012 MitMem_regMaintenance of mitochondrial structure and function
ORUY PF05160 DSS1_SEM1DSS1/SEM1 family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling