| Link type | Probability | Chain L piercings | Chain R piercings | Chain U piercings | Chain Y piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
| view details |
|
Other | 42% | -358R -389U -8Y +100Y -121Y +137Y -158Y +207Y -248Y +295Y | -69U -389Y | -64Y | |||||||||
Chain L Sequence |
KLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV |
Chain L Sequence |
NPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM |
Chain L Sequence |
LAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVE---------SKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEE |
Chain L Sequence |
EKKQPVDLGLLEEDDEFEEFPAEDW-------DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKME |
| sequence length | 375,376,292,66 |
| structure length | 375,376,283,59 |
| publication title |
An atomic structure of the human 26S proteasome.
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | Proteasome subunit beta type-6 |
| source organism | Homo sapiens |
| missing residues | U: 142-152 Y: 27-35 |
| pdb deposition date | 2016-07-01 |
| LinkProt deposition date | 2016-09-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| LRUY | PF00004 | AAA | ATPase family associated with various cellular activities (AAA) |
| LRUY | PF01399 | PCI | PCI domain |
| LRUY | PF10602 | RPN7 | 26S proteasome subunit RPN7 |
| LRUY | PF01398 | JAB | JAB1/Mov34/MPN/PAD-1 ubiquitin protease |
| LRUY | PF13012 | MitMem_reg | Maintenance of mitochondrial structure and function |
| LRUY | PF05160 | DSS1_SEM1 | DSS1/SEM1 family |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
