5GJQILUY

Structure of the human 26s proteasome bound to usp14-ubal
I: 84-91 U: 142-152 Y: 27-35
Link type Probability Chain I piercings Chain L piercings Chain U piercings Chain Y piercings
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
view details
Other Other 37% -57L +110L +390L +429U -296Y -430I +140I -153I -225I -390L
Interpreting sequences
Chain I Sequence
LERIKDYLLMEEEFIRNQEQ------KQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYK
Chain I Sequence
KLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
Chain I Sequence
LAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVE---------SKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEE
Chain I Sequence
EKKQPVDLGLLEEDDEFEEFPAEDW-------DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKME
sequence length 365,375,292,66
structure length 359,375,283,59
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
missing residues I: 84-91 U: 142-152 Y: 27-35
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ILUY PF00004 AAAATPase family associated with various cellular activities (AAA)
ILUY PF00004 AAAATPase family associated with various cellular activities (AAA)
ILUY PF01398 JABJAB1/Mov34/MPN/PAD-1 ubiquitin protease
ILUY PF13012 MitMem_regMaintenance of mitochondrial structure and function
ILUY PF05160 DSS1_SEM1DSS1/SEM1 family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling