5GJQFaef

Structure of the human 26s proteasome bound to usp14-ubal
Link type Probability Chain F piercings Chain a piercings Chain e piercings Chain f piercings
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
view details
Other Other 33% +175e -242e +6e -92e +105e -122e -142e -241f
Interpreting sequences
Chain F Sequence
YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI
Chain F Sequence
TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATL
Chain F Sequence
TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSG
Chain F Sequence
RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
sequence length 234,202,201,213
structure length 234,202,201,213
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
ec nomenclature ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
Faef PF00227 ProteasomeProteasome subunit
Faef PF10584 Proteasome_A_NProteasome subunit A N-terminal signature
Faef PF00227 ProteasomeProteasome subunit
Faef PF00227 ProteasomeProteasome subunit
Faef PF00227 ProteasomeProteasome subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling