5GJQBDad

Structure of the human 26s proteasome bound to usp14-ubal
Link type Probability Chain B piercings Chain D piercings Chain a piercings Chain d piercings
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
view details
Other Other 30% +164D -180D +9a -245a
Interpreting sequences
Chain B Sequence
SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAER
Chain B Sequence
SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREK
Chain B Sequence
TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATL
Chain B Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQ
sequence length 244,250,202,199
structure length 244,250,202,199
publication title An atomic structure of the human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
source organism Homo sapiens
ec nomenclature ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
ec 3.4.25.1: Proteasome endopeptidase complex.
pdb deposition date2016-07-01
LinkProt deposition date2016-09-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
BDad PF00227 ProteasomeProteasome subunit
BDad PF10584 Proteasome_A_NProteasome subunit A N-terminal signature
BDad PF00227 ProteasomeProteasome subunit
BDad PF10584 Proteasome_A_NProteasome subunit A N-terminal signature
BDad PF00227 ProteasomeProteasome subunit
BDad PF00227 ProteasomeProteasome subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling