5FV8ABDE

Structure of cjun-fosw coiled coil complex.
Link type Probability Chain A piercings Chain B piercings Chain D piercings Chain E piercings
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
view details
Other Other 42% +13D -37D +12A -37A -9A +33A +33E
Interpreting sequences
Chain A Sequence
ASLDELQAEIEQLEERNYALRKEIEDLQKQLEKLGA
Chain A Sequence
ASLDELQAEIEQLEERNYALRKEIEDLQKQLEKLG
Chain A Sequence
ASIARLEEKVKTLKAQNYELASTANMLREQVA
Chain A Sequence
ASIARLEEKVKTLKAQNYELASTANMLREQVAQLGAP
sequence length 36,35,32,37
structure length 36,35,32,37
publication title Helix-Constrained Fos-Based Peptides Inhibit Oncogenic Activator Protein-1 and Cancer Cell Proliferation
rcsb
molecule tags Structural protein
molecule keywords FOSW
pdb deposition date2016-02-03
LinkProt deposition date2017-06-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling