| Link type | Probability | Chain A piercings | Chain B piercings | Chain C piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
| view details |
|
Other | 57% | +53B +140C -181D | -217A | ||||||||||
Chain A Sequence |
PEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTAT-----TKNRFVV |
Chain A Sequence |
RIIYDRKFLMECRN |
Chain A Sequence |
KHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTA--------NRFVV |
Chain A Sequence |
RIIYDRKFLMECRN |
| sequence length | 187,14,182,14 |
| structure length | 182,14,174,14 |
| publication title |
Design of nucleotide-mimetic and non-nucleotide inhibitors of the translation initiation factor eIF4E: Synthesis, structural and functional characterisation
doi rcsb |
| molecule tags | Translation |
| molecule keywords | Eukaryotic translation initiation factor 4E |
| source organism | Homo sapiens |
| missing residues | A: 205-211 C: 204-213 |
| pdb deposition date | 2015-11-04 |
| LinkProt deposition date | 2016-09-12 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
