5E79dhx

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain d piercings Chain h piercings Chain x piercings
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
view details
Hopf.2 U Ring Hopf.2 U Ring 30% -41x +79x -90x +110x -40d -66h
Interpreting sequences
Chain d Sequence
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Chain d Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Chain d Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS
sequence length 342,65,39
structure length 342,65,39
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling