| Link type | Probability | Chain d piercings | Chain e piercings | Chain f piercings | Chain y piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
| view details |
|
Other | 30% | +35e +352f -46y | -352d -47f -353y | +36d +40e +47y | |||||||||
Chain d Sequence |
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL |
Chain d Sequence |
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK |
Chain d Sequence |
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR |
Chain d Sequence |
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL |
| sequence length | 342,81,34,29 |
| structure length | 342,81,34,29 |
| publication title |
Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 1 |
| pdb deposition date | 2015-10-12 |
| LinkProt deposition date | 2017-02-10 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
