5E79defl

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain d piercings Chain e piercings Chain f piercings Chain l piercings
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
view details
Other Other 31% +85e +101f -38f -38f -297l -346l +25d +11e
Interpreting sequences
Chain d Sequence
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Chain d Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain d Sequence
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
Chain d Sequence
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
sequence length 342,81,34,37
structure length 342,81,34,37
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling