5E79defj

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain d piercings Chain e piercings Chain f piercings Chain j piercings
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
view details
Other Other 34% +85e +65f -75f +218f -46j -325d +342d -352d +33d +84e
Interpreting sequences
Chain d Sequence
ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Chain d Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain d Sequence
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
Chain d Sequence
SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
sequence length 342,81,34,38
structure length 342,81,34,38
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling