| Link type | Probability | Chain c piercings | Chain j piercings | Chain l piercings | Chain t piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
| view details |
|
Other | 56% | -40j -136l | -65t +86t +429t -474t | +30t | |||||||||
Chain c Sequence |
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD |
Chain c Sequence |
SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL |
Chain c Sequence |
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN |
Chain c Sequence |
METITYVFIFACIIALFFFAIFFREPPRIT |
| sequence length | 451,38,37,30 |
| structure length | 451,38,37,30 |
| publication title |
Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb |
| molecule tags | Photosynthesis |
| molecule keywords | Photosystem II protein D1 1 |
| pdb deposition date | 2015-10-12 |
| LinkProt deposition date | 2017-02-10 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
