5E79ceiv

Macromolecular diffractive imaging using imperfect crystals
Link type Probability Chain c piercings Chain e piercings Chain i piercings Chain v piercings
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
view details
Other Other 32% -9e -474i -38v -441c +137i +137i -79v +95v +186v +303v
Interpreting sequences
Chain c Sequence
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Chain c Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Chain c Sequence
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE
Chain c Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
sequence length 451,81,38,137
structure length 451,81,38,137
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
pdb deposition date2015-10-12
LinkProt deposition date2017-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling